Protein Info for Pf6N2E2_2243 in Pseudomonas fluorescens FW300-N2E2
Annotation: RelE/StbE replicon stabilization toxin
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to HIGB2_VIBCH: Toxin HigB-2 (higB-2) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
KEGG orthology group: None (inferred from 76% identity to pfo:Pfl01_0270)Predicted SEED Role
"RelE/StbE replicon stabilization toxin"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A165Z7A7 at UniProt or InterPro
Protein Sequence (104 amino acids)
>Pf6N2E2_2243 RelE/StbE replicon stabilization toxin (Pseudomonas fluorescens FW300-N2E2) MIFIETPIFTRRVKELMDDDDFAVLQKILVRDPSAGDVMEATGGIRKIRIAAKGHGKRGG ARVIYYHFVHASRIALLMIYPKNEQQDLTVDQRTALKMIVEHWR