Protein Info for Pf6N2E2_2237 in Pseudomonas fluorescens FW300-N2E2

Annotation: Exodeoxyribonuclease III (EC 3.1.11.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 TIGR00195: exodeoxyribonuclease III" amino acids 4 to 257 (254 residues), 236 bits, see alignment E=5.3e-74 TIGR00633: exodeoxyribonuclease III (xth)" amino acids 4 to 258 (255 residues), 233.4 bits, see alignment E=3.2e-73 PF03372: Exo_endo_phos" amino acids 7 to 251 (245 residues), 104.3 bits, see alignment E=4.2e-34

Best Hits

Swiss-Prot: 35% identical to EX3_SALTY: Exodeoxyribonuclease III (xthA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01142, exodeoxyribonuclease III [EC: 3.1.11.2] (inferred from 98% identity to pba:PSEBR_a1798)

Predicted SEED Role

"Exodeoxyribonuclease III (EC 3.1.11.2)" in subsystem DNA repair, bacterial (EC 3.1.11.2)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.2

Use Curated BLAST to search for 3.1.11.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z7A0 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Pf6N2E2_2237 Exodeoxyribonuclease III (EC 3.1.11.2) (Pseudomonas fluorescens FW300-N2E2)
MKNLRIATFNINGIRARLPNLLEWLEREKPDIACLQELKAVDNDFPAAELESVGYGAIWH
GQASWNGVAILARDAQPLESRRGLPGGDDDSHSRYLEAAVHGVLVGCLYLPNGNPQPGPK
FDYKLAWFERLIDYAQGLQASDHPVVLAGDYNVVPTDMDIYNPRSWLKDALLQPESRACY
QRLLDQGWTDSLRHLYPDERVYTFWDYFRQHWQKNSGLRIDHLLLNPAASAYLSEAGVDA
WVRNQPHPSDHAPTWIRLASRKRR