Protein Info for Pf6N2E2_2235 in Pseudomonas fluorescens FW300-N2E2

Annotation: Xanthine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 382 to 404 (23 residues), see Phobius details amino acids 410 to 433 (24 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 21 to 431 (411 residues), 340.5 bits, see alignment E=1.5e-105 PF00860: Xan_ur_permease" amino acids 22 to 401 (380 residues), 307.3 bits, see alignment E=6.7e-96 TIGR03173: xanthine permease" amino acids 24 to 434 (411 residues), 510.1 bits, see alignment E=3.8e-157

Best Hits

Swiss-Prot: 40% identical to PBUX_BACSU: Xanthine permease (pbuX) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a1800)

MetaCyc: 40% identical to urate:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN0-530

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVB7 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Pf6N2E2_2235 Xanthine permease (Pseudomonas fluorescens FW300-N2E2)
MKTPHVSLPRPEDENLGVGANMAYGLQHVLTMYGGIVAVPLIIGQAAGLSPADIGLLIAA
SLFAGGLATLLQTLGLPFFGCQLPLVQGVSFSGVATMVAIVGSGGEGGFQAILGAVIAAS
LIGLLITPVFSRITRFFPPLVTGIVITTIGLTLMPVAARWAMGGNSHAADFGSMANIGLA
AVTLVLVLLLSKMGSATISRLSILLAMVIGTVIAVFLGMADFSSVSQGPMFGFPTPFHFG
MPTFHIAAILSMCIVIMVTLVETSADILAVGEIIDTKVDSRRLGNGLRADMLSSMIAPIF
GSFTQSAFAQNVGLVAVTGIKSRFVVATGGVFLVVLGLLPFMGRVIAAVPTSVLGGAGIV
LFGTVAASGIRTLSKVDYRNNVNLIIVATSIGFGMIPIAAPNFYDHFPSWFATIFHSGIS
SSAIMAIVLNLAFNHFTAGNSDQQSVFAAGTERVLRYQDLAALREGDYFSDGKLHDCDGN
EIPVVAEPVHGVAEHGPIRLKSSEHV