Protein Info for Pf6N2E2_221 in Pseudomonas fluorescens FW300-N2E2

Annotation: RND efflux system, membrane fusion protein CmeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 41 to 376 (336 residues), 267 bits, see alignment E=9.9e-84 PF25917: BSH_RND" amino acids 66 to 208 (143 residues), 67.6 bits, see alignment E=2e-22 PF25878: HH_AAEA_pHBA" amino acids 102 to 172 (71 residues), 32.4 bits, see alignment E=3.1e-11 PF25876: HH_MFP_RND" amino acids 106 to 175 (70 residues), 62.4 bits, see alignment E=1.2e-20 PF25944: Beta-barrel_RND" amino acids 212 to 301 (90 residues), 75.1 bits, see alignment E=1.4e-24 PF25954: Beta-barrel_RND_2" amino acids 267 to 302 (36 residues), 23.2 bits, see alignment 1.9e-08 PF25967: RND-MFP_C" amino acids 307 to 367 (61 residues), 63.9 bits, see alignment E=3.1e-21

Best Hits

Swiss-Prot: 46% identical to ACRA_ECO57: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli O157:H7

KEGG orthology group: K03585, membrane fusion protein (inferred from 98% identity to pba:PSEBR_a3651)

MetaCyc: 46% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YND7 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Pf6N2E2_221 RND efflux system, membrane fusion protein CmeA (Pseudomonas fluorescens FW300-N2E2)
MSTKLFAKSLVTAAILVCLIVLFMLGGCSGESAPTPEPPKVSVITVQPQSQALTTELAGR
TQAFMVAEIRPQVGGIVQQRLFVEGAEVKAGQALYQLDASSYKAALAEAQANLAKARATL
KSAQATAKRDAQLVKIDAISQQDNEDAQANLMTAEAEVQVAQADVDTARINLAYTRISSP
VSGRVETSTVTPGALVVANQDSALTTVQQLDPMYVDVTQSTTELLRLKRDLASGVLQSNG
EGEARIRLKLDDGSTYAHEGRLKFSGVSVNEGTGTVTLRAQIANPDRLLLPGMYVRAVLE
QARDDKAILIPQKAVTRSASGATSVLVVVDGKVEQRMLTIDRAVDNQWWVTAGLNAGDQV
IVEGGQKVRVGETVVAQNTGTRSRTQKATPVAIAQEG