Protein Info for Pf6N2E2_2204 in Pseudomonas fluorescens FW300-N2E2

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 PF13855: LRR_8" amino acids 16 to 71 (56 residues), 28.1 bits, see alignment 4.2e-10 amino acids 127 to 185 (59 residues), 29.2 bits, see alignment E=1.9e-10 PF00560: LRR_1" amino acids 37 to 58 (22 residues), 14 bits, see alignment (E = 1.4e-05) PF07714: PK_Tyr_Ser-Thr" amino acids 205 to 383 (179 residues), 61.3 bits, see alignment E=2.8e-20 PF00069: Pkinase" amino acids 206 to 375 (170 residues), 49.7 bits, see alignment E=1e-16 PF06293: Kdo" amino acids 276 to 384 (109 residues), 33.3 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a1827)

Predicted SEED Role

"serine/threonine protein kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZV92 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Pf6N2E2_2204 serine/threonine protein kinase (Pseudomonas fluorescens FW300-N2E2)
MHTLAQLRAGQLCGITRLDLTCGLTEFPREIFDVADSLEILNLSGNQLDTLPDDLHRLTR
LRVLFCSDNRFTELPECLGRCSALTMVGFKANRIAHVAGAALPPLLRWLILTDNCVSRLP
DELGQRPYLQKLMLAGNRLQQLPASLGQCHRLELLRIAANQLTELPQWLLTLPSLSWLAY
AGNPLETQAQATALNTTTPIEWSHLELQRQLGEGASGVIHQALWQTPGQAARKVAVKLYK
GQMTSDGSPLHEMHACITAGRHSNLIEVLGQVAGHPEQQAGLVMALIEPSYRNLAGLPSL
ASCSRDVYADELRLSAPVALRIAHGIASVAAHLHRHGITHGDLYGHNILCDEQGDCLLGD
FGAASFHATTDNLQTRALQRIEVRAFGILLGELLARIEPTPSAEELAALQDLQVRCCQPE
VLARPGFDEIRQLLSSF