Protein Info for Pf6N2E2_217 in Pseudomonas fluorescens FW300-N2E2

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 128 to 150 (23 residues), see Phobius details PF00512: HisKA" amino acids 203 to 262 (60 residues), 49.1 bits, see alignment E=4.7e-17 PF02518: HATPase_c" amino acids 313 to 418 (106 residues), 73.1 bits, see alignment E=2.5e-24

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a3655)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YN96 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Pf6N2E2_217 Signal transduction histidine kinase (Pseudomonas fluorescens FW300-N2E2)
MMKPSRLFWKLFLAFWLATSLTFLVGLGLLVMGSSRPGDPHLETVLATEEQLLRQFGIES
GRQLLAVWEHPDDQAVGVYDSAGQLLAGTPVPQPAYERSIIGKDGIVLSLKSSHPLDKKG
DRGPSHWTPLIIGTVMSALFSGYMAFYLAWPLAYLRRAMSDVAQGRFETRVKPIMGERRD
EIVDLAEDCDRMANQLKLLVDAQQHLLHDISHELRSPLTRMQAAIGLLQQDPARLEMVER
IDRESVRMDTLIEALLTLARLQGRPESIEREPIDVVELLSVIVEDARFEAQMKGCQVTLQ
ACPAFVSRVSGELLYRCFENVIRNAVRHTRPNTTVMVVAKVNGVADGLTVQISDQGAGVE
HSRLQSIFNPFERGLNEVSAGFGLGLAIASRSVEIHGGTILARNEPSGGLTVEISLPRRG