Protein Info for Pf6N2E2_2166 in Pseudomonas fluorescens FW300-N2E2

Annotation: protein of unknown function DUF6, transmembrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details PF00892: EamA" amino acids 171 to 301 (131 residues), 29.1 bits, see alignment E=5.6e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYW5 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Pf6N2E2_2166 protein of unknown function DUF6, transmembrane (Pseudomonas fluorescens FW300-N2E2)
MRTAHALFVGITALMLVNVIDGLKEVYFGILLQRLDSVIATFVLFAVAWPVFFLGYMARK
RSTPALLATPEKKASIRRCLLMLNVSSAALWISFLLALKWVEPAIVSALVGGVGIISTLV
LNKLLRPTAIMIRADYIAALVIALASVYLGWVSMDGRTAVRDEFDSNQVLLGYLMMLVCG
VAMALTSILSKVVADHGASSHYLYAHRFYLLLAITGVYTSLNLSEIAAVIDHLDALVLLA
FVGVILPLLLLQEGIKRCEPVTTEAILAAAPLFTIIFQTVDSRLAFSVFSFAGVVLICLA
ATYNGYSHLSRLSVEGVRT