Protein Info for Pf6N2E2_2156 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative polyketide synthase (Fragment)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 23 to 39 (17 residues), see Phobius details PF03807: F420_oxidored" amino acids 25 to 114 (90 residues), 70.9 bits, see alignment E=1.1e-23 PF10727: Rossmann-like" amino acids 25 to 115 (91 residues), 26 bits, see alignment E=7e-10

Best Hits

KEGG orthology group: K06988, (no description) (inferred from 81% identity to pfo:Pfl01_2073)

Predicted SEED Role

"Putative polyketide synthase (Fragment)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161HA15 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Pf6N2E2_2156 Putative polyketide synthase (Fragment) (Pseudomonas fluorescens FW300-N2E2)
MYLNGGHHRQAYPTLRTQDMSSIDTIGIIGAGAIGSAFARALARQNINVVIANSRGPQSL
AELVADLGPSVRAGTVEQAAAQPMVLVAVNWSKLPQALGGLPDFAGRIVIDANNAIEVPG
FKAVDLQGRASTEVFSEWVPGARVVKAFNHLLARLLEADPTSEGGKRVLFLTGDDAQARG
EVAQLIERLGFFGVDLGPLSVGARLTQFPGGPLPVLNLVKFD