Protein Info for Pf6N2E2_214 in Pseudomonas fluorescens FW300-N2E2

Annotation: dTDP-Rha:A-D-GlcNAc-diphosphoryl polyprenol, A-3-L-rhamnosyl transferase WbbL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 159 to 178 (20 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 23 to 251 (229 residues), 58.4 bits, see alignment E=2e-19 PF00535: Glycos_transf_2" amino acids 25 to 151 (127 residues), 53.9 bits, see alignment E=4.3e-18 PF13712: Glyco_tranf_2_5" amino acids 73 to 246 (174 residues), 32.8 bits, see alignment E=1.2e-11 PF13632: Glyco_trans_2_3" amino acids 155 to 285 (131 residues), 36 bits, see alignment E=1.3e-12

Best Hits

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a3658)

Predicted SEED Role

"dTDP-Rha:A-D-GlcNAc-diphosphoryl polyprenol, A-3-L-rhamnosyl transferase WbbL" in subsystem dTDP-rhamnose synthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GMG4 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Pf6N2E2_214 dTDP-Rha:A-D-GlcNAc-diphosphoryl polyprenol, A-3-L-rhamnosyl transferase WbbL (Pseudomonas fluorescens FW300-N2E2)
MKLEAVELLAMDEWATSSLRGECDVIIVNYNAGKLLLACVGSAFAAGASRVIVVDNDSHD
DSLMLVERTHAAGNSLQIVRNAANLGFAVACNQGARLSAAPNLFFLNPDTVLAADAIDHL
LLALRSAPEIGMVGGFLCNPDGSEQAGGRRVFPTPRRAFMRAFGLSRLSVLFPSLLSDFL
LHKEPLPGTPVVVEAISGACMLVKREAIESVGLWDEDYFLHCEDLDWCMRFHQAGWRVLF
VPDARVMHVFGGCSRHRPYFVEWHKHLGFLRFYRKFFRRKYPTVLWISVVIGVWFRFGLV
VLRHATTRFRNAWNLR