Protein Info for Pf6N2E2_2124 in Pseudomonas fluorescens FW300-N2E2

Annotation: Mg(2+) transport ATPase protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details PF02308: MgtC" amino acids 32 to 157 (126 residues), 129.2 bits, see alignment E=5.5e-42

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 99% identity to pba:PSEBR_a1897)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWG6 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Pf6N2E2_2124 Mg(2+) transport ATPase protein C (Pseudomonas fluorescens FW300-N2E2)
MDAWWHEVWITLQAEFADITDAQQMTRVTVRLLMAALLGGILGFEREHKGKAAGVRTHML
VALGAALFVLVPQMSGSQADAMSRVIQGVVAGIGFLGAGTILKNTDGDEGHVKGLTTAAG
LWMTAAIGVAAGLGREATAVLSTILALAIFSVMPVIVRALEKDPN