Protein Info for Pf6N2E2_212 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glycosyl transferase, group 2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 724 PF13692: Glyco_trans_1_4" amino acids 295 to 425 (131 residues), 30.9 bits, see alignment E=7.6e-11 PF13641: Glyco_tranf_2_3" amino acids 462 to 681 (220 residues), 71.3 bits, see alignment E=2.9e-23 PF00535: Glycos_transf_2" amino acids 463 to 633 (171 residues), 108.5 bits, see alignment E=9e-35 PF13506: Glyco_transf_21" amino acids 532 to 680 (149 residues), 34.1 bits, see alignment E=5e-12 PF13632: Glyco_trans_2_3" amino acids 544 to 679 (136 residues), 27.1 bits, see alignment E=9.3e-10

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a3660)

Predicted SEED Role

"Glycosyl transferase, group 2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YN49 at UniProt or InterPro

Protein Sequence (724 amino acids)

>Pf6N2E2_212 Glycosyl transferase, group 2 family protein (Pseudomonas fluorescens FW300-N2E2)
VLKLDSTLIDRDAALAQRDAAINERDIALAKVDFLQNTRSWRFTRPLRSLFRWMRYGFAA
TQEFPDTAAAIVYPAAPEPLPNVEVEADFDTKGRLDILCFANIDWAARFQRPQQLMSQFA
SNGYRVFYIVPARVPEQAQLYGLTSVAPNVFEVVLQREAQEAYYEKIVTPENHQALLRAL
AALVADMQIRTALSVVHIAYWSPVALSLRAMHGWRILYDCMDDWDGFPNIGEQLLSEEKT
LVAQADLVTVSAALLYHKWCAHNPRCVLVRNAVDFAFFRQHCFTNDVLNGLVGPVIGYYG
ALAQWLDFPLLAALADRRPEWNFVLVGDIFVDDLAGLERKPNVQLLGRKPYSQMPLYLDH
FDACLIPFRLYNVTHAVDPVKFYEYISAGKPVISTPLTEMSIYKDLLYFATGVDEFIEQI
ERALAERDLALYKRRVELARANDWKDRFNSMQLAIVGLYEKVSIVLVTYNNLNLTIQCVN
SILRNTTWPNYQLIVVDNGSEDGTGDYLERLRQEVPTAKVILNPDNRGFAAANNQGLREA
DGDILLLLNNDTVVPGGWLDPLVRHLREPSIGLVGPVTNAVGNEAKIAISYTDIQQMQDF
ADRYTEARKGQTFDISMLAMFCVAFRRSILEEVGYLDEAFGIGMFEDDDYSRRVQAAGYR
TVCAEDAFIHHYGQASFRKLIASGEYQALWDKNQAYFESKWGAWQAHVHRDEPGGETGEK
AGSQ