Protein Info for Pf6N2E2_2111 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): Dehydrocarnitine CoA-transferase and acetoacetate CoA-transferase, subunit A
Rationale: Very important on cartinine and also important on L-phenylalanine and L-leucine. Acts on dehydrocarnitine during carnitine catabolism to give dehydrocarnitine-CoA. Probably also acts on acetoacetate, which is an intermediate in the degradation of phenylalanine (via tyrosine and homogentistate) and leucine (from HMG-CoA lyase). Both substrates are 3-oxoacids, but not sure if succinyl-CoA is the source of the CoA as annotated. Note that acetoacetyl-CoA is probably cleaved to acetyl-CoA by _2113 (downstream). Similar to DhcA = PA1999.
Original annotation: Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02429: 3-oxoacid CoA-transferase, A subunit
  • amino acids 5 to 217 (213 residues), 245.8 bits, E=1.6e-77
• PF01144: CoA_trans
  • amino acids 10 to 217 (208 residues), 256.7 bits, E=7.5e-81

Best Hits

Swiss-Prot: 65% identical to SCOA_BACSU: Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A (scoA) from Bacillus subtilis (strain 168)

KEGG orthology group: K01028, 3-oxoacid CoA-transferase subunit A [EC: 2.8.3.5] (inferred from 100% identity to pba:PSEBR_a1906)

MetaCyc: 63% identical to succinyl-CoA-transferase subunit A (Helicobacter pylori 26695)
3-oxoacid CoA-transferase. [EC: 2.8.3.5]

Predicted SEED Role

"Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5)" in subsystem Catechol branch of beta-ketoadipate pathway or Leucine Degradation and HMG-CoA Metabolism or Protocatechuate branch of beta-ketoadipate pathway or Serine-glyoxylate cycle (EC 2.8.3.5)

MetaCyc Pathways

• ketolysis (3/3 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Synthesis and degradation of ketone bodies
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.5

Use Curated BLAST to search for 2.8.3.5

Sequence Analysis Tools

See A0A159ZX12 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Pf6N2E2_2111 Dehydrocarnitine CoA-transferase and acetoacetate CoA-transferase, subunit A (Pseudomonas fluorescens FW300-N2E2)
MAGFDKRVSSYEEALEGLKDGMTVIAGGFGLCGIPENLIAEIKRKGIRDLTVVSNNCGVD
GFGLGVLLEDRQIRKVVASYVGENALFEQQLLSGEIEVVLTPQGTLAEKMRAGGAGIPAF
FTATGVGTPVAEGKEVREFHGRQYLMEESITGDFAIVKGWKADHFGNVIYRHTAQNFNPL
AATAGKITVVEVEEIVEPGELDPTQIHTPGIYVDRVICGTFEKRIEQRTVRK