Protein Info for Pf6N2E2_2109 in Pseudomonas fluorescens FW300-N2E2

Annotation: NAD-dependent protein deacetylase of SIR2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF02146: SIR2" amino acids 27 to 228 (202 residues), 151.8 bits, see alignment E=1e-48

Best Hits

Swiss-Prot: 71% identical to NPD3_PSESM: NAD-dependent protein deacetylase 3 (cobB3) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a1908)

MetaCyc: 45% identical to NAD-dependent lipoamidase SIRT4 (Homo sapiens)
RXN-22964 [EC: 2.3.1.313]

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.313

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z6C6 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Pf6N2E2_2109 NAD-dependent protein deacetylase of SIR2 family (Pseudomonas fluorescens FW300-N2E2)
MPDDFHGEPLDQLQAYMAGRRFLVLTGAGISTPSGIPDYRDSDGVRRGRQPMMYQEFLAQ
AEARRRYWARAMLGWPRVRQARPNVAHDALAQLQAQQRITGLITQNVDTLHDQAGSQDVI
ELHGSLHRVLCLDCGQRSERQQIQLSMEAQNPYLAGVDAVQAPDGDTLLDPAFEARFQVP
NCPHCAGERLKPDVVFFGENVAPATATRATEAVQQADGLLVVGSSLMAYSAFRLCRAIKD
QGKPLLVINRGKTRADDLLDLKLEEPCEKLLPLLTQHPF