Protein Info for Pf6N2E2_21 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sigma-70 factor FpvI (ECF subfamily), controling pyoverdin biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF07638: Sigma70_ECF" amino acids 1 to 150 (150 residues), 32.9 bits, see alignment E=1.2e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 2 to 153 (152 residues), 79.9 bits, see alignment E=8.2e-27 PF04542: Sigma70_r2" amino acids 2 to 66 (65 residues), 40.6 bits, see alignment E=3.7e-14 PF08281: Sigma70_r4_2" amino acids 98 to 150 (53 residues), 63.4 bits, see alignment E=2.5e-21 PF04545: Sigma70_r4" amino acids 103 to 151 (49 residues), 35.1 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 99% identity to pba:PSEBR_a3907)

Predicted SEED Role

"Sigma-70 factor FpvI (ECF subfamily), controling pyoverdin biosynthesis" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YGX4 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Pf6N2E2_21 Sigma-70 factor FpvI (ECF subfamily), controling pyoverdin biosynthesis (Pseudomonas fluorescens FW300-N2E2)
MLENYYRELVCFLNARLGNRQAAEDVVHDAYVRVLERASDTPIEQPRAFLYRTALNLVID
GHRRNTLRQVESLEVLDSEERFFTPSPQTSLDHGQRLDMLQRALAELPPLCRESFLLRKL
EGLSHPQIAERLGISRALVEKHIVNAMKHCRVRVRQWDAH