Protein Info for Pf6N2E2_2096 in Pseudomonas fluorescens FW300-N2E2

Annotation: TonB-dependent siderophore receptor precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 825 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF07715: Plug" amino acids 161 to 264 (104 residues), 70.9 bits, see alignment E=1.9e-23 TIGR01783: TonB-dependent siderophore receptor" amino acids 163 to 825 (663 residues), 371.4 bits, see alignment E=5e-115 PF00593: TonB_dep_Rec_b-barrel" amino acids 385 to 793 (409 residues), 187.5 bits, see alignment E=1.3e-58

Best Hits

Swiss-Prot: 68% identical to PBUA_PSEU4: Ferric-pseudobactin M114 receptor PbuA (pbuA) from Pseudomonas sp. (strain M114)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 93% identity to pba:PSEBR_a1921)

Predicted SEED Role

"TonB-dependent siderophore receptor precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZV12 at UniProt or InterPro

Protein Sequence (825 amino acids)

>Pf6N2E2_2096 TonB-dependent siderophore receptor precursor (Pseudomonas fluorescens FW300-N2E2)
MSWVSAPGRLVFAVKIGLLAAATGSAGAVNASPVPEASAQQRWVQAYDIGAGSLVDVLTR
FSSAAGVAISFDARQLQGLRSPGLSGSFGVVDGFARILGGSGLQADFQPNGTYVLRPVPG
NGSAMELGVTTIDGQRLGATTENSGSYTTGAVTIGKGEHSLRETPQSVTVITRKMLDDQN
LNTIDQVMEKTPGITVYDSTMGGKYFYSRGFRMSGQYQYDGVPLDMGNSYVQADSFSSDM
AYYDRVEVLRGAAGMMKGSGGTSGGVNFVRKRGLAAAQTELSLSGGTWDNYRGQIDTGGP
LNDSGTVRGRAVIAEQSRHYFYDDARRKDQIYYGALDFDLSPDTTLGLGVAYEDVDASPC
WGGLPRYRDGSDLKLSRSTCLDPSWNTWRSQRTTVFGDLKHQLNDDWAVKVAGVYTKNTQ
DIKYAFASGSVTPGISTTNMLGSMYDYDQVDYGLDAYLDGKFDAFGQQHEWVVGFNASRS
DKDDFFSVALLPEKQNVFDPDRHIPEPDDSYFIENSTRGGPVKTVTEQQGMYSTLRLKLA
DPLTFVVGSRVSWYSSKTDSVFLTGGSEHAKSTETGQVTPFAAVLLDLNEHLTAYASYSD
IFTPQGNYRSESGSALKPLVGESYELGIKGEWFEGRLNSAFNLFRTLQKDQAQTDYISSC
SSSDGFCYENAGKVRAQGFEAEISGEVIERLQLLAGYTYTQTKTLDDIDTSLNGGSFNSY
VPRHVLRLWGDYALGGALERFSVGAGVNAQSDNFRVSPATGEKITQAGYAVWNGRLGYRI
DDTWSLALNGNNLFDKRYYATIGTEGFGNYYGEPRNFTLSMKARF