Protein Info for Pf6N2E2_2095 in Pseudomonas fluorescens FW300-N2E2

Annotation: Permeases of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 transmembrane" amino acids 33 to 50 (18 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details amino acids 249 to 274 (26 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details amino acids 442 to 466 (25 residues), see Phobius details amino acids 485 to 505 (21 residues), see Phobius details amino acids 511 to 529 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 25 to 231 (207 residues), 109.1 bits, see alignment E=2.6e-35 amino acids 231 to 333 (103 residues), 26.9 bits, see alignment E=2.3e-10 PF07690: MFS_1" amino acids 29 to 333 (305 residues), 86 bits, see alignment E=2.4e-28

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a1922)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWL0 at UniProt or InterPro

Protein Sequence (540 amino acids)

>Pf6N2E2_2095 Permeases of the major facilitator superfamily (Pseudomonas fluorescens FW300-N2E2)
MSEHVQSLEATRSVGTSQETQKVIFASSLGTVFEWYDFFLYGALAAVISKQFFAGVNDTT
AFIFALMAFAAGFIVRPFGALVFGRLGDMIGRKYTFLATIILMGVATFCVGLLPNYASIG
IAAPIILVVLRMLQGLALGGEYGGAATYVAEHAPMGKRGFHTSWIQSTATLGLLLSLLVV
LGCRYFTGDQFEVWGWRIPFLLSILLLGISTWIRLSLHESPAFLKMKEEGKSCKAPIRES
FGKWENLKVVLIALFSINAGQAVTFYAAQFYVLFFLTQFLKMDPALANSLLIVSVVIGAP
FFIFFGWLSDKVGRKPVLMIGLLLATALYFPIFKTLAHYANPAIDQASRQAPITVIADPA
TCTFQFDPVGKARFDSPCDKVKTFLVKQGLPYSSVAAPAGSTVQVSVGDVKLEGYDEAAL
RGAVTLAGYPQQADAQQINRPMIVALIVALIIISAMCYGPLAALMVELFPTRIRYTSMSL
PYHIGNGWFGGFLPTVSFALVVYTGDIFYGLWYPVVITGVSLVVGMICLRETRSVDLDKN