Protein Info for Pf6N2E2_2086 in Pseudomonas fluorescens FW300-N2E2

Annotation: DNA polymerase-like protein PA0670

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00817: IMS" amino acids 24 to 150 (127 residues), 32.8 bits, see alignment E=3.1e-12

Best Hits

KEGG orthology group: K14161, protein ImuB (inferred from 96% identity to pba:PSEBR_a1931)

Predicted SEED Role

"DNA polymerase-like protein PA0670" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZV04 at UniProt or InterPro

Protein Sequence (473 amino acids)

>Pf6N2E2_2086 DNA polymerase-like protein PA0670 (Pseudomonas fluorescens FW300-N2E2)
MRWVCILFPQLALDAALRQRPDPDQPLALLTGPAQRRVLQAVNAPARALGLRPGQTMTAA
QALSKGFATAEYDAAQIEHWQQFLAAWAYRFSAQVSVHYPRTLLFEIESSLGLFGPWPVF
EARLRAELTELGFRHRIVAAPNPVAARVLANAYDALVVPDAETLQQCLGDMPVERIGLEP
DVATALSRMGLRRLSQVQALPRQTLARRFEAQVLKHLDALMGHRTLALSFYLPPDRFDVR
IELNYDVQSHQALLFPLRRLTGDLSAFLCGRDSGVQRFDLHLEHAGLPDTVIKVGLLSAE
RAPAMLFELARGRLEQVQVEAPVRGFRLCAEDLPSFVPQRLELFDERPQQSLPWEQLRER
LRARLGDEAVQGLGFRDDHRPECAWQMTSQPRSQACPVRDGVQRPGWLLEEPQALAQGQA
HILMGPERIETGWWDGADVRRDYYLIETRRGQRGWAYRTVGEGGPLWLQGWFA