Protein Info for Pf6N2E2_2064 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cobalt-precorrin-3b C17-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01890: CbiG_C
  • amino acids 2 to 126 (125 residues), 111.5 bits, E=1.8e-36

Best Hits

KEGG orthology group: K02189, cobalamin biosynthesis protein CbiG (inferred from 93% identity to pba:PSEBR_a1950)

Predicted SEED Role

"Cobalt-precorrin-3b C17-methyltransferase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (13/13 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (13/15 steps found)

Sequence Analysis Tools

See A0A159ZUY9 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Pf6N2E2_2064 Cobalt-precorrin-3b C17-methyltransferase (Pseudomonas fluorescens FW300-N2E2)
MLVVGLGCQRGCPASTLRALLDETLLAHGIGLHRVRALASIDLKRDEPGLLELAGQLALP
LTCFSVEQLAGYEQRLSHRSEIAFQRTGCYGIAESAALALADQLGTTPATLLITRQKGPN
STLALAVVA