Protein Info for Pf6N2E2_2055 in Pseudomonas fluorescens FW300-N2E2

Annotation: StbE replicon stabilization toxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 TIGR02385: addiction module toxin, RelE/StbE family" amino acids 4 to 81 (78 residues), 29.7 bits, see alignment E=3.6e-11 PF05016: ParE_toxin" amino acids 5 to 83 (79 residues), 52.4 bits, see alignment E=3.4e-18

Best Hits

Swiss-Prot: 59% identical to RELE_SHIFL: mRNA interferase RelE (relE) from Shigella flexneri

KEGG orthology group: K06218, RelE protein (inferred from 70% identity to vfm:VFMJ11_A0688)

MetaCyc: 59% identical to Qin prophage; mRNA interferase toxin RelE (Escherichia coli K-12 substr. MG1655)
3.1.26.-

Predicted SEED Role

"StbE replicon stabilization toxin" in subsystem Toxin-antitoxin replicon stabilization systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z5Z5 at UniProt or InterPro

Protein Sequence (93 amino acids)

>Pf6N2E2_2055 StbE replicon stabilization toxin (Pseudomonas fluorescens FW300-N2E2)
MTYELEFSDKAWKEWQKLGATLREQFKKKLEERLVNPHVPADRLAGLGNAYKIKLRSAGY
RLVYRVVDDVLVVTVIAVGKRERGQVYDEAARR