Protein Info for Pf6N2E2_2039 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF00989: PAS" amino acids 23 to 81 (59 residues), 24.9 bits, see alignment E=7.9e-09 PF08448: PAS_4" amino acids 26 to 117 (92 residues), 29.9 bits, see alignment E=2.5e-10 PF14532: Sigma54_activ_2" amino acids 159 to 330 (172 residues), 77.8 bits, see alignment E=4.5e-25 PF00158: Sigma54_activat" amino acids 159 to 326 (168 residues), 222.3 bits, see alignment E=1.5e-69 PF01078: Mg_chelatase" amino acids 173 to 268 (96 residues), 20.4 bits, see alignment E=1.3e-07 PF07728: AAA_5" amino acids 181 to 299 (119 residues), 29.2 bits, see alignment E=3.7e-10 PF02954: HTH_8" amino acids 426 to 462 (37 residues), 44.1 bits, see alignment 6.3e-15

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1973)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYN3 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Pf6N2E2_2039 Sigma-54 dependent transcriptional regulator (Pseudomonas fluorescens FW300-N2E2)
MNPTESLKDYKRVRTLAIRSLFEIIEQSSEGTVIVDRDANIVWMNERYARRFGLNSAQEA
IGRACESVIPSSLLREVVRTGRPILLDMQDTPKEPLVVMRLPIHDSAGAVIGAIGFALFD
ELRSLSPMLKRYLSMQEELASTRSLLRARQTKYNFAHFIGTSNAGLEVKRRARRSASADS
PVLLLGETGTGKELLAQAIHSASPRAHKAFVSINSAAIPESLLEAEFFGTAPGAFTGADR
KGRAGKLQIAQGGTLFLDEIGDMPLPLQSKLLRVLQEKEYEPVGSNEVLQSDVRVIAATS
MDLEAAIKRGEFRADLYYRLNVLPIHVPPLRERLDDLPALSEAILEELRSQHELNPTALA
LLCQHAWPGNIRELRNVLERAALLSDDLVLTAADIRAAIGTFIPVTRPASPSLEPLPQET
FSQARARFDRQLIETTLAQCGGKVVEAAERLGLGRSTLYKKMVALGIADSQ