Protein Info for Pf6N2E2_2023 in Pseudomonas fluorescens FW300-N2E2

Annotation: Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF00583: Acetyltransf_1" amino acids 35 to 125 (91 residues), 36.5 bits, see alignment E=1.1e-12 PF13673: Acetyltransf_10" amino acids 48 to 132 (85 residues), 31.4 bits, see alignment E=3.6e-11 PF13508: Acetyltransf_7" amino acids 50 to 125 (76 residues), 32.3 bits, see alignment E=2.2e-11 PF08445: FR47" amino acids 73 to 131 (59 residues), 22.8 bits, see alignment E=1.5e-08

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a1983)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYK4 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Pf6N2E2_2023 Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1) (Pseudomonas fluorescens FW300-N2E2)
MSFEWRAATNGDIDFARQLTCDNMLPYYLRHDLLWQDEAFDLAWIIRQNWIISREGQALG
FVSLSRDARALYIRELQVNEAFRGQGAGTWTIGQVWDLVVLERRPALRLTVFKDNPARAL
YERMGLRVVGEDECFLRMQRDIGA