Protein Info for Pf6N2E2_2021 in Pseudomonas fluorescens FW300-N2E2

Annotation: Excinuclease ABC subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 TIGR00194: excinuclease ABC subunit C" amino acids 1 to 563 (563 residues), 589 bits, see alignment E=5.4e-181 PF01541: GIY-YIG" amino acids 2 to 71 (70 residues), 30.8 bits, see alignment E=8.7e-11 PF02151: UVR" amino acids 183 to 214 (32 residues), 32.8 bits, see alignment (E = 1.3e-11) PF08459: UvrC_RNaseH_dom" amino acids 361 to 516 (156 residues), 180.6 bits, see alignment E=5.9e-57 PF14520: HHH_5" amino acids 531 to 580 (50 residues), 39.2 bits, see alignment 2.3e-13 PF12826: HHH_2" amino acids 534 to 582 (49 residues), 28.3 bits, see alignment 4.7e-10

Best Hits

Swiss-Prot: 94% identical to UVRC_PSEPF: UvrABC system protein C (uvrC) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 99% identity to pba:PSEBR_a1985)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUP9 at UniProt or InterPro

Protein Sequence (585 amino acids)

>Pf6N2E2_2021 Excinuclease ABC subunit C (Pseudomonas fluorescens FW300-N2E2)
MFDSEARLLYVGKAKNLKKRLASYFRKTGLAPKTSALVGRIAQIETTITANETEALLLEQ
TLIKEWRPPYNILLRDDKSYPYVFLSDGAFPRLSIHRGAKKAKGRYFGPYPSAGAIRESL
SLLQKTFFVRQCEDSYYKNRTRPCLQYQIKRCKAPCVGFVEPQVYAEDVRHSVMFLEGRS
NALTDELSAAMEDAAVNLEFERAAELRDQIGLLRRVQDQQSMEGGSGDVDVIAAFINPGG
ACVHLISVRGGRVLGSKNFFPQVGIEEDVSEVMAAFLGQYYISSPERDLPAELIVNVVHE
DFPALIEAIDKLRGRELTISHRVRGTRARWQQLAVTNAEQALGARLANRQHVAARFDALA
DVLNLDEPPQRLECYDISHSSGEATVASCVVFGPEGPIKSDYRRYNIEGVTPGDDYAAMH
QALMRRFGKLKDGEGKLPDILLVDGGKGQLSMARDVLNELMVPDLILLGVAKGATRKAGF
ETLYLNDAAHEFTLKGDSPALHLIQQIRDEAHRFAITGHRARRGKTRRTSTLEGVAGVGP
TRRRDLLKHFGGLQELSRASIEEIAKAPGISKKLAESIYANLHSE