Protein Info for Pf6N2E2_202 in Pseudomonas fluorescens FW300-N2E2

Annotation: 4Fe-4S ferredoxin, iron-sulfur binding

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 307 to 324 (18 residues), see Phobius details amino acids 337 to 361 (25 residues), see Phobius details amino acids 381 to 400 (20 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 5 to 39 (35 residues), 27.3 bits, see alignment 6.1e-10 PF01494: FAD_binding_3" amino acids 5 to 39 (35 residues), 26.3 bits, see alignment 1.1e-09 PF00890: FAD_binding_2" amino acids 6 to 44 (39 residues), 26 bits, see alignment 1.3e-09 PF13450: NAD_binding_8" amino acids 9 to 40 (32 residues), 25.8 bits, see alignment (E = 2.6e-09)

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a3670)

Predicted SEED Role

"4Fe-4S ferredoxin, iron-sulfur binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YMV5 at UniProt or InterPro

Protein Sequence (528 amino acids)

>Pf6N2E2_202 4Fe-4S ferredoxin, iron-sulfur binding (Pseudomonas fluorescens FW300-N2E2)
VKPEFDVIIVGSGPAGTSAAYPLVKAGLKVLMVDAQADTGSVTAPTRPFLSARANDEHQW
KWMIGENFHALSQLDAVSPKLKTPTHAHVFEGFSARNRIETDNFIGIGSLATGGLSNAWG
CGVATLGASDFAGLPIDYSEMQASYETVTRRIGISGRIDDDLSSYFGLDEWSQPPLPLDT
LHQRLLDQYTRRRSAFPEQGFRLGRSRVAVLSQPLDERKACDLSGNCLWGCQNQALYSAS
QELQKLKQYPGFQHVQDFLVEDLQKLDGAWAITDHRCARRFCGTRLLLATGTLATTRLAL
KGLNHSSPIPLLSSPTAAFLLWLPKMLGTPRVSTFGLGQLSFVLALTASTTAFGSTFSTT
GLPMTEFVSRIPMSKRYSIELLKNLLSACVVGNIFLPGHLSHNTAVLRPDGSLSINGHEH
PELPGLMKTAEAKLRRIYWKMGALLMPMSFTVGRPGADIHYAGTLPMHSAPRIGQTDRLG
EIAGLGGVHIVDGACLPSLTEKSHTLTLMANADRIARSLVTTIGNHKA