Protein Info for Pf6N2E2_1999 in Pseudomonas fluorescens FW300-N2E2

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 336 to 350 (15 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details amino acids 444 to 468 (25 residues), see Phobius details PF07916: TraG_N" amino acids 10 to 485 (476 residues), 249.7 bits, see alignment E=3.3e-78

Best Hits

KEGG orthology group: None (inferred from 81% identity to pba:PSEBR_a1992)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUM4 at UniProt or InterPro

Protein Sequence (501 amino acids)

>Pf6N2E2_1999 putative membrane protein (Pseudomonas fluorescens FW300-N2E2)
MTLYTNDYLEYYLTLVGWIVNNGIWEMLVASGVFTLPFLAIIVQEWLRARSEGADEGNKG
VLSSLRIENRVWVAIVVIMFAGVPFIDVDLNTIAFDDTRSTQCQVSIATPQDTRWSNTFT
TLNNQSAKVPVWWFFMHSLSKALTGGATAAIPCGTDLRQIRIDIDTARIDDPLLAQEVAD
FSQDCYGPARAKLFMNRPTLSEALMDDINWIGSKYLLDTHDYYDAYRSKTPRSRWPYNSA
RDAGLLQVPGGGGYPSCKQWWSDVGHGLRGRLLRQVDPNLLFRLTQWARFLSMAQAEDAV
VRSVASPRQQTLNQGQVYSSYAGQIDMSASNLTARLASDLGLTVGATAYFPAMDVVRQAL
PMVLSFLKMALTISIPLILVIGTYELKALVTISCVQFALFFVDFWFQLARWLDSTILDAL
YGWNSPHSNFNVLLGANNSFGDMLLNYVMATLFIVLPAFWVTSLAWVGVRTGNLIHGLTD
STKAAGQAGAEGGEWISKRLK