Protein Info for Pf6N2E2_1990 in Pseudomonas fluorescens FW300-N2E2

Annotation: Possible exported protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details TIGR03746: integrating conjugative element protein, PFL_4703 family" amino acids 4 to 207 (204 residues), 315.5 bits, see alignment E=6.4e-99 PF11444: DUF2895" amino acids 7 to 206 (200 residues), 309.7 bits, see alignment E=3.7e-97

Best Hits

KEGG orthology group: None (inferred from 85% identity to pba:PSEBR_m643)

Predicted SEED Role

"Possible exported protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z5B1 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Pf6N2E2_1990 Possible exported protein (Pseudomonas fluorescens FW300-N2E2)
MSRFKNEVLHLQSHVRTLRLCTGGLFLVVVGLGAGWWNAPRDLTIHVPPDLRSGSTRKWW
EIPPESVYAFTFYIFQQLNRWPNDGEDDYSRNLQSLTAYLTPACRSFFQQDYDQRRRLGE
LRKRVRGVYEIPGRGYGDDPETRVKVVSDNDWLVTLDINADEYHGAEQVKRALVRYPIKV
VRLDIDPELNPFGLALDCYEGTPQRITLPTSSAPATRTLDRPLGDAS