Protein Info for Pf6N2E2_1986 in Pseudomonas fluorescens FW300-N2E2

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 20 to 52 (33 residues), see Phobius details amino acids 134 to 178 (45 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details TIGR03747: integrating conjugative element membrane protein, PFL_4697 family" amino acids 16 to 249 (234 residues), 284.9 bits, see alignment E=2.4e-89 PF14348: DtrJ-like" amino acids 51 to 246 (196 residues), 213.8 bits, see alignment E=9.1e-68

Best Hits

KEGG orthology group: None (inferred from 64% identity to pba:PSEBR_a2000)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z597 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Pf6N2E2_1986 putative membrane protein (Pseudomonas fluorescens FW300-N2E2)
MSEPSSTAQRQQRQQRGFVFGLITLPFRFVAVLFGSLLLNIVIECIGMYAFWPEDGWRHA
RQMFEYELGQLSSDFKRSVLVQEPGRSANAIVQLVYEGVLIKTGIIRSLKETSEGAARAH
AEATHQPHYYIALLYMHLENNLIAAAFCVLVFVVRLMVLFLSVPLLFMAAFIGLVDGLVQ
RDIRRFGAGRESGYVYHRAKACVMPLLTWPWVVYLALPVSLNAAWILLPGAILLAITLSL
AASRFKKYL