Protein Info for Pf6N2E2_1966 in Pseudomonas fluorescens FW300-N2E2

Annotation: SAM-dependent methyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF13489: Methyltransf_23" amino acids 35 to 206 (172 residues), 32.3 bits, see alignment E=2e-11 PF13649: Methyltransf_25" amino acids 55 to 149 (95 residues), 51.5 bits, see alignment E=3.3e-17 PF13847: Methyltransf_31" amino acids 55 to 154 (100 residues), 38.3 bits, see alignment E=2.8e-13 PF08242: Methyltransf_12" amino acids 56 to 150 (95 residues), 30.9 bits, see alignment E=9.4e-11 PF08241: Methyltransf_11" amino acids 56 to 151 (96 residues), 48.1 bits, see alignment E=3.7e-16

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a2017)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZW97 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Pf6N2E2_1966 SAM-dependent methyltransferases (Pseudomonas fluorescens FW300-N2E2)
MPDPIKLEFSEKYDDKHAQSYLLKHQDNLARRLSHKRDEQLARSALVAAGEPGLVLDLPC
GAGRFWPLLAQKPGRVIIGADNSESMLKVATIAQPAEVVKRVRPLQTSAFAIDLPDNAVD
NIFCMRLMHHIGAPEHRLAILREFQRVTRDSVIISLWVDGNFKAWKRKRTEVRRRNKGEQ
NSYQNRFVLSATTVEAEFEQAGFRVQKSLDFIPLYAMWRVYVLRKK