Protein Info for Pf6N2E2_1959 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): D-sorbitol dehydrogenase (EC 1.1.1.14)
Rationale: Specifically important in carbon source D-Sorbitol. This is the first step in sorbitol degradation.
Original annotation: Multiple polyol-specific dehydrogenase (EC 1.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 7 to 190 (184 residues), 179.4 bits, E=9e-57
• PF08659: KR
  • amino acids 9 to 163 (155 residues), 32.2 bits, E=1.5e-11
• PF13561: adh_short_C2
  • amino acids 13 to 253 (241 residues), 173.4 bits, E=9.5e-55

Best Hits

Swiss-Prot: 80% identical to SDH_RHOSH: Sorbitol dehydrogenase (polS) from Rhodobacter sphaeroides

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a2028)

MetaCyc: 62% identical to galactitol 2-dehydrogenase (Agrobacterium fabrum C58)
Galactitol 2-dehydrogenase. [EC: 1.1.1.16]

Predicted SEED Role

"Multiple polyol-specific dehydrogenase (EC 1.1.1.-)" in subsystem Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.-)

MetaCyc Pathways

• D-sorbitol degradation I (3/3 steps found)
• mannitol cycle (3/5 steps found)
• D-altritol and galactitol degradation (1/4 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.14

Use Curated BLAST to search for 1.1.1.- or 1.1.1.14 or 1.1.1.16

Sequence Analysis Tools

See A0A159ZYE1 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Pf6N2E2_1959 D-sorbitol dehydrogenase (EC 1.1.1.14) (Pseudomonas fluorescens FW300-N2E2)
MKRLEGKSALITGSARGIGRSFAQAYIGEGATVAIADINLERAQATASELGPQAYAVEMD
VTRQASIDAAIAEVVARAGKLDILVNNAALFDLAPITEITRESYDKLFAINVSGTLFTLQ
AAAKQMISQGHGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIKHKINVNA
IAPGVVDGEHWDGVDALFAKHENRPLGEKKRLVGLEVPYGRMGTAEDLVGMAIFLAGSES
DYIVAQTYNVDGGNWMS