Protein Info for Pf6N2E2_1913 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 160 to 177 (18 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details PF05145: AbrB" amino acids 1 to 269 (269 residues), 261.7 bits, see alignment E=3.9e-82 TIGR03082: membrane protein AbrB duplication" amino acids 118 to 269 (152 residues), 139 bits, see alignment E=5.7e-45

Best Hits

KEGG orthology group: K07120, (no description) (inferred from 67% identity to pst:PSPTO_3277)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>Pf6N2E2_1913 Putative transport protein (Pseudomonas fluorescens FW300-N2E2)
MTLAVLLSIAQSWPMMLLATAATVCLSALVGLALVWAGIPASTAAWGTAPGAASAMVSMA
DEYGADSRVVATMQYVRVVCVVMIGALVSHWVGAPTGGETHVTNVEPQSFGLLNLGLTIA
TLLAGVALGNRVPAGALLMPLLLGGALQISGLLHIALPDWLLATAYGALGCYVGLRFDRP
TIGYVWRRLPAMIMGATLLIALCALSAWLLATISDRDFLSIYLATSPGGLDTMAIIAVDT
HSDVGLVLAMQTLRLFAVILTGAFVARLIIRLSEHRQITS