Protein Info for Pf6N2E2_1910 in Pseudomonas fluorescens FW300-N2E2

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 303 to 328 (26 residues), see Phobius details amino acids 340 to 361 (22 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 342 (321 residues), 133 bits, see alignment E=6.5e-43

Best Hits

Swiss-Prot: 40% identical to NEPI_SHISS: Purine ribonucleoside efflux pump NepI (nepI) from Shigella sonnei (strain Ss046)

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a2070)

MetaCyc: 40% identical to purine ribonucleoside exporter (Escherichia coli K-12 substr. MG1655)
RXN0-18; RXN0-22

Predicted SEED Role

"transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X764 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Pf6N2E2_1910 transcriptional regulator (Pseudomonas fluorescens FW300-N2E2)
MTTSTLNTAQIDSRIWSAVGSLTLCVALLIAAEFMPVSLLTPIANDLHTSQGMAGQAISI
SGFFAVVASLCIASIAGRFDRRHVLVSMTLLMLISLVVIALAPGFTWLMIARAFLGVAIG
GFWALSTATVLRIVPEEAVPKALGMIYMGHSVAAAFAAPIGAYVGGHLGWRFVFAALVPI
VIINVIWQYKSLPAMQPEKTIPLSRLFGVLKRRNVMFGLLAAMLTFGGTFTAFTYLRPFL
EQVTGVDSTQLSVLLLSLGIAGFGGTYIVSRLLEKQFLFQLLRWLPVALAVMTVALAELG
YSFAAAAIMMFAWGMLYSAIPVCWSTWLAKEVSDEPETGGGLMVAAIQMAIMVGGAFGGS
LLDHVSVTAPLIGGSVLLILAALVVGNGGRLTQSTPA