Protein Info for Pf6N2E2_191 in Pseudomonas fluorescens FW300-N2E2

Annotation: ClpB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF07724: AAA_2" amino acids 73 to 250 (178 residues), 128.2 bits, see alignment E=8.2e-41 PF00158: Sigma54_activat" amino acids 77 to 200 (124 residues), 26.1 bits, see alignment E=1.6e-09 PF07728: AAA_5" amino acids 78 to 203 (126 residues), 34.7 bits, see alignment E=4.4e-12 PF00004: AAA" amino acids 78 to 190 (113 residues), 25.6 bits, see alignment E=3.8e-09 PF10431: ClpB_D2-small" amino acids 262 to 325 (64 residues), 39.8 bits, see alignment E=9.3e-14

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a3684)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YML0 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Pf6N2E2_191 ClpB protein (Pseudomonas fluorescens FW300-N2E2)
MPLVNDRIDPNHPQPGLTSASPAAELLTSRFAFNPAQVMALLRSRIVGQEHVMRVVEALL
NVVKVDIGERERPLTVNLFMGPTGVGKTEIVRLLALAIHGRADAFCRIDMHTLAQEHYSA
ALTGAPPGYVGSKEGVSLFNSELIQGTYSRPGIVLFDELEKASKEVVRSLLGILENGQLT
LAGGSRTLDFRNSLIFMTSNIGARQATTYRERFSRGWRRWLGIAPQGEQAMLELALHAWF
EPEFLNRIDRILVFQRIETQWLEALLQIELNKLNQRLGQHRRTLVLDVAASDWLCQKHDP
RFGARALTRRVRVELEPAIAECLLAYPQAMQMAATVESNRLRVVPLA