Protein Info for Pf6N2E2_1905 in Pseudomonas fluorescens FW300-N2E2

Annotation: Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 4 to 51 (48 residues), 32.8 bits, E=5.5e-12
• PF01799: Fer2_2
  • amino acids 71 to 142 (72 residues), 85.3 bits, E=2.6e-28

Best Hits

Swiss-Prot: 49% identical to NICA_PSEPK: Nicotinate dehydrogenase subunit A (nicA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K07302, isoquinoline 1-oxidoreductase, alpha subunit [EC: 1.3.99.16] (inferred from 100% identity to pba:PSEBR_a2075)

MetaCyc: 78% identical to 2-deoxy-D-ribose dehydrogenase alpha subunit (Pseudomonas simiae)
1.1.2.M2 [EC: 1.1.2.M2]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

MetaCyc Pathways

• 2-deoxy-D-ribose degradation II (4/8 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.1.2.M2 or 1.3.99.16

Sequence Analysis Tools

See A0A0N7H395 at UniProt or InterPro

Protein Sequence (148 amino acids)

>Pf6N2E2_1905 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) (Pseudomonas fluorescens FW300-N2E2)
MELNVNGTVYEVEADADTPLLWVIRDDIGLTGTKYGCGLAQCGACSVMVDGVLLRSCVTP
VEGVKGKQIRTIEAIEDDELGKRVVAAWVKHQVAQCGYCQSGQVMAATALLQRIPKPSQA
DIAAAMTNLCRCGTYNAIKTAVDELAGA