Protein Info for Pf6N2E2_1903 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative diheme cytochrome c-553

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details PF00034: Cytochrom_C" amino acids 326 to 412 (87 residues), 45.7 bits, see alignment E=1.4e-15 PF13442: Cytochrome_CBB3" amino acids 326 to 408 (83 residues), 38.4 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2077)

Predicted SEED Role

"Putative diheme cytochrome c-553" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X6F6 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Pf6N2E2_1903 Putative diheme cytochrome c-553 (Pseudomonas fluorescens FW300-N2E2)
VNKTIKYLLPAGIVVAAGLGWFVNRTPFSPFANEASAPSADAQLVQRGEYVARLSDCVAC
HSTPKGAPFAGGLEMATPMGSIYATNITPDKQTGIGNYSLADFDRAVRSGVAADGHRLYP
AMPYPSYAKLSDDDVRALYAFFMAGVKPAQQQNQQSHIPWPLNMRWPLALWNTAFVDDGA
YQAKPSEDALWNRGAYIVQGAGHCGSCHTPRSLTMNEKSLDESSATFLSGSLLDGWYAPS
LRQDPNTGLGRWSEQEIVDYLKTGRNAHSVVVGTMAEVFNNSTQYMSDPDLKAIAHYLVS
LPGDPKRDGPPWKPAAKLAEQPLSTPGAANYMAKCSSCHGSDGSGQAPWIPPLAGASSSM
VKEGATSINATLNGSERVVANGIPDSYRMPPYRNQLSDQEVADVLTFVRTSWGNQGGAVK
ADEVKELRERTNPASSNPIILQMR