Protein Info for Pf6N2E2_1899 in Pseudomonas fluorescens FW300-N2E2

Annotation: Dienelactone hydrolase and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 PF06500: FrsA-like" amino acids 12 to 150 (139 residues), 28.3 bits, see alignment E=2.5e-10 PF02129: Peptidase_S15" amino acids 29 to 176 (148 residues), 36.2 bits, see alignment E=1.7e-12 PF01738: DLH" amino acids 34 to 150 (117 residues), 29.8 bits, see alignment E=1.3e-10 PF12697: Abhydrolase_6" amino acids 71 to 297 (227 residues), 29.5 bits, see alignment E=3.6e-10 PF05448: AXE1" amino acids 104 to 154 (51 residues), 24.2 bits, see alignment 3.8e-09

Best Hits

Swiss-Prot: 80% identical to Y2218_PSEAE: Uncharacterized protein PA2218 (PA2218) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06889, (no description) (inferred from 98% identity to pba:PSEBR_a2082)

Predicted SEED Role

"Dienelactone hydrolase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUE2 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Pf6N2E2_1899 Dienelactone hydrolase and related enzymes (Pseudomonas fluorescens FW300-N2E2)
MQLTQEWDKTFAKSDKVDHKKITFTNRYGITLAGDLYQPKSASAKLAAIVVCGPFGAVKE
QSSGLYAQTMAERGFVTLAFDASYTGESSGEPRNVASPDINTEDVSAAVDALSLQPSVDR
ERIGVIGICGWGGMALNAVALDKRVKAVVASTMYDMTRVMSKGYNDSVTLEQRTQGLEQL
SAQRWVDAENGAPAYQPPYNELRGGEVQFMVDYHDYYSTTRGHHPRAVNSGNSWTVTTPL
SFMNMPILTYIAEISPRPVLFIHGENAHSRYFSETAYAAAAQPKELMIIPEASHTDLYDR
VDVIPFDKLTTFFTQHLATAAGAA