Protein Info for Pf6N2E2_1891 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sulfur oxidation molybdopterin C protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details TIGR04555: sulfite dehydrogenase" amino acids 20 to 432 (413 residues), 583.6 bits, see alignment E=1.1e-179 PF00174: Oxidored_molyb" amino acids 125 to 284 (160 residues), 167 bits, see alignment E=3e-53 PF03404: Mo-co_dimer" amino acids 307 to 420 (114 residues), 61.4 bits, see alignment E=9.9e-21

Best Hits

KEGG orthology group: None (inferred from 62% identity to bja:bll6121)

Predicted SEED Role

"Sulfur oxidation molybdopterin C protein" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GUH5 at UniProt or InterPro

Protein Sequence (435 amino acids)

>Pf6N2E2_1891 Sulfur oxidation molybdopterin C protein (Pseudomonas fluorescens FW300-N2E2)
MTKKSMIPAKQDMPQTALARRDFLIKSGAIIGTAAFALGDSDLVNAQTTNIAPPDPSQPL
EVPQWTRSLGAPTANPYGKPSTFETKAVRILYPGLKDTMSAYSTSPLQELDGIITPNGLF
YERHHAGVPQIDPAQHRLVIHGLTETALIFTMDEIRQFPAVSRVHFMECSGNPSFLPPWG
KTAAEVSGLVSCAEWTGVTLKTLLDEAGLKPQAKWIIAEGADGAAMTRSIPIEKCLDDVM
VVYSQNGERLRPEQGYPLRLFVPGYEGNTHIKWLRRLHVTDAPAYSREETAKYTDLMADG
KARKFSFVMECKSLVTYPSGTQKLTRKGLHEMRGIAWSGHGKITRVDVSVDGGNNWTQAR
LQEPILTKALTVFRAPFEWNGQELMIMSRAIDETGYVQPMLDQLINERGKVSFYHNNSVQ
PWRVSSTGEVTNGRA