Protein Info for Pf6N2E2_1884 in Pseudomonas fluorescens FW300-N2E2

Annotation: oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00106: adh_short" amino acids 7 to 192 (186 residues), 178.6 bits, see alignment E=2.1e-56 PF01370: Epimerase" amino acids 9 to 175 (167 residues), 21.5 bits, see alignment E=2.8e-08 PF08659: KR" amino acids 9 to 169 (161 residues), 55.2 bits, see alignment E=1.7e-18 PF13561: adh_short_C2" amino acids 13 to 219 (207 residues), 137.8 bits, see alignment E=9.3e-44

Best Hits

Swiss-Prot: 50% identical to Y1627_STAS1: Uncharacterized oxidoreductase SSP1627 (SSP1627) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: None (inferred from 82% identity to sch:Sphch_2512)

MetaCyc: 44% identical to clavulanate dehydrogenase subunit (Streptomyces clavuligerus)
RXN-8893

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUD4 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Pf6N2E2_1884 oxidoreductase, short-chain dehydrogenase/reductase family (Pseudomonas fluorescens FW300-N2E2)
MTSKIDKVVLITGASSGIGEATTRELAAAGARLFIGARRGTRLEALADELGENVAWRELD
VTDGCAFDAFAGAAKERFGRIDALVNNAGVMPLSMLAALKRDEWKRMIDVNIHGVLNGIA
AVLPDFIAQKNGHVINIASIAARIVMPSSSVYSATKHAVRAITEGLRQEHDMIRTTLISP
GPTATELGHDVTDPDIAAMLKVSIPQGMSPDAIARAIRYALEQPDSVDVNELVVRPTASA
M