Protein Info for Pf6N2E2_1882 in Pseudomonas fluorescens FW300-N2E2

Annotation: Thioredoxin reductase (EC 1.8.1.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01266: DAO" amino acids 3 to 67 (65 residues), 29.3 bits, see alignment E=1.3e-10 PF07992: Pyr_redox_2" amino acids 3 to 139 (137 residues), 41.3 bits, see alignment E=2.7e-14 amino acids 172 to 284 (113 residues), 36.1 bits, see alignment E=1e-12 PF00890: FAD_binding_2" amino acids 3 to 45 (43 residues), 21.5 bits, see alignment 2.5e-08

Best Hits

KEGG orthology group: None (inferred from 86% identity to sch:Sphch_2510)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUL6 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Pf6N2E2_1882 Thioredoxin reductase (EC 1.8.1.9) (Pseudomonas fluorescens FW300-N2E2)
MNDVIIIGGSFAGLAAALQLGRARRKVTVLDTGLPRNRFAGRSHGVLGHDHKPPSDILAE
ARQQLARYPTIQLVNARAESVSGAIDDFSVLTGEGETLRARRLILSYGVADQMPAVPGFA
EGWGTSIIPCPYCDGFEVADQHWGLVWFRPQSHIQVKLFQHWTDRLTVFADGHDIAPDLR
ADLAHRNIPVVDGRITGIARHGGHSATVKLDTGPDVVVDILFAHPPTKPSASLHDSLGLA
TVDTPLGIVLKVDERRETSIPGIYAAGDLATPGMPSVTTASWQGATAGISAQQSMLT