Protein Info for Pf6N2E2_1877 in Pseudomonas fluorescens FW300-N2E2

Annotation: putative transmembrane efflux protein.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details amino acids 270 to 287 (18 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 343 (314 residues), 54.8 bits, see alignment E=3.8e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>Pf6N2E2_1877 putative transmembrane efflux protein. (Pseudomonas fluorescens FW300-N2E2)
MQDNADGIFRARPIQKVAALVIPCLASLPIMVMPFIFGAVIDQVQVDSSNATYATSAEIS
MIALASLLVSIALKVLPPRLTALIGLSLAAIGHFLSIGSTSLEPMIIARAIAGFGEGLCM
GMGFATLAQIIGGTRLLAYSSGIVAAASLISFITVPALQSHLGSSSIFWFMLVVTLICFP
LFIWMPTAKLKQLPNAGGVYALFNIKSFSLFLVAFLASSGSNTLWLYFEQVGHSVGMDLA
AIGKLGSFSSIPTLLVPFVANFIFARNKTVVPIAVVCLLSGIASYFYGAPPSVIAFCSVV
VIMSFLYVFLIAYIRMFSAHLDSSGRTTAAVGGADSLGMVVGPLVAAFTLNLTTGFSSLS
SFGLALQSLCVIPCLGFLFYKASRHTRSVGNA