Protein Info for Pf6N2E2_1875 in Pseudomonas fluorescens FW300-N2E2

Annotation: Protoporphyrinogen oxidase (EC 1.3.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01946: Thi4" amino acids 3 to 41 (39 residues), 26.4 bits, see alignment 1.4e-09 PF00070: Pyr_redox" amino acids 4 to 46 (43 residues), 24.7 bits, see alignment 9.6e-09 PF00890: FAD_binding_2" amino acids 5 to 40 (36 residues), 28.2 bits, see alignment 4e-10 PF01266: DAO" amino acids 5 to 38 (34 residues), 34.3 bits, see alignment 7.1e-12 PF13450: NAD_binding_8" amino acids 7 to 72 (66 residues), 56 bits, see alignment E=1.3e-18 PF01593: Amino_oxidase" amino acids 12 to 437 (426 residues), 120.3 bits, see alignment E=4.7e-38

Best Hits

KEGG orthology group: K00231, protoporphyrinogen oxidase [EC: 1.3.3.4] (inferred from 44% identity to sch:Sphch_0453)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZY86 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Pf6N2E2_1875 Protoporphyrinogen oxidase (EC 1.3.3.4) (Pseudomonas fluorescens FW300-N2E2)
MTKNIIVVGSGISGLSAAYDLTKAGHKVTVLESTATAGGRMADVDMKGLNVHSGATIIWD
NFKDMMGLVNELGMKDQLVSWTRDATRVDNGQKVYDIQYHFSVSNMLTHPAFGTATKLKL
AKLLPDIIRSGLKTDPCFMHTAAEFDTESVAEYLTDKGVVDFLENYIEPLFRAPWNWEPE
EFSKAYLLTMMGHLPTAKTHTFKYGIGSLTRELAKHVDVKYQTKVLSIVEKQGAGCDVQI
ENNDGTHILQADIVVFAAPADRASALVSTLNNEEKAFFESVKYNECGIVYYVLSKPLEQK
LQWYTRKHPSPVVFYAQIPEDEHVPEGHRQPPHLYLELTPQQRDRAVAEGGTGNLKQYVH
QFAKDMYPAVDEDTVEVIEQWIPQMLPLWYPGYAKKVAAFIETYEAAPRSIYFAGDYLAH
SHTGGACASGRRAARLIQKHWN