Protein Info for Pf6N2E2_1871 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cytochrome c oxidase polypeptide III (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 46 to 175 (130 residues), 39.9 bits, E=2.3e-14

Best Hits

KEGG orthology group: None (inferred from 50% identity to fsy:FsymDg_2696)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (3/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

See A0A159ZW36 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Pf6N2E2_1871 Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Pseudomonas fluorescens FW300-N2E2)
LEGIWVFVGLDMMIFALLFGSFMVERLKNPDTFEASRQALNLHFGGGNTLILLTSSWCMV
RAVQAARRRTAVGPWLAAALAGGIAFGISKVVEYMGKIQAGYTMLTNDFFMFYFALTGIH
LLHVVAGCVALAVFWAHARAGTYARDSSLAGIESMGIYWHMVDLLWIILFPLLYLMR