Protein Info for Pf6N2E2_1861 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ferredoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF07992: Pyr_redox_2" amino acids 8 to 304 (297 residues), 239.4 bits, see alignment E=1.5e-74 PF13738: Pyr_redox_3" amino acids 65 to 258 (194 residues), 31.6 bits, see alignment E=2.7e-11 PF00070: Pyr_redox" amino acids 149 to 229 (81 residues), 55.4 bits, see alignment E=1.9e-18 PF14759: Reductase_C" amino acids 323 to 407 (85 residues), 119.1 bits, see alignment E=2.5e-38

Best Hits

Swiss-Prot: 50% identical to CAMA_PSEPU: Putidaredoxin reductase CamA (camA) from Pseudomonas putida

KEGG orthology group: K00529, ferredoxin--NAD+ reductase [EC: 1.18.1.3] (inferred from 54% identity to bcm:Bcenmc03_6887)

MetaCyc: 50% identical to NADH-putidaredoxin reductase (Pseudomonas putida ATCC 17453)
RXN-13138 [EC: 1.18.1.5]

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.3 or 1.18.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZX32 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Pf6N2E2_1861 Ferredoxin reductase (Pseudomonas fluorescens FW300-N2E2)
MYPQNETAVIVGAGHAGAELVATLRQNGYPGRIILIGDEPELPYRRPPLSKTYLSGEASR
ESLLIRSAAAYDKLQVACWTGVQVCAIDRERRTVTLSDGRTQAYDKLVLATGGRPRRLEE
PAAQKPNVHYIRNLADIERLQPDFVAGKRLLVIGGGYIGLEAASVGIKNGLQVTVLEAAP
RVLARVAAPEISAFYEGVHRRRGVDVRTETSVQVFQGAERVESVQLSDGSELPVDLIIVG
IGILPNDQLARDAGLEIDNGIVVDSYAQTLDPDILAVGDCARHVNGFLGCLIRIESVPSA
QEQARTAAHTICGKNLPHIAVPWFWSDQFDLKLQMVGLSQGYDQLVLRGDMAAESFCAFY
LRKGVVLSVDAVNRPQDFMVGKRLVAERVQVDPQVLADESIDLKSLLAAAL