Protein Info for Pf6N2E2_1845 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG005548: transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 831 transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 343 to 366 (24 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 436 to 453 (18 residues), see Phobius details amino acids 639 to 658 (20 residues), see Phobius details amino acids 664 to 685 (22 residues), see Phobius details amino acids 692 to 714 (23 residues), see Phobius details amino acids 735 to 755 (21 residues), see Phobius details amino acids 767 to 791 (25 residues), see Phobius details PF03176: MMPL" amino acids 180 to 435 (256 residues), 33.3 bits, see alignment E=1.4e-12 amino acids 590 to 790 (201 residues), 56.5 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 58% identity to gme:Gmet_2244)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (831 amino acids)

>Pf6N2E2_1845 FIG005548: transport protein (Pseudomonas fluorescens FW300-N2E2)
MIDSKHEGAGLMSVIRDPALFNRLSGNFFERMIFNHRLLIIAFCVIATLLSAWQARNLTV
TTSFDKMLPHGHPFIRNFLDNRDQLRGLGDSVRFVVENRKGDVFDAEYLKTLGQINDELF
RIPGVDRTWVKSIWTPVVRWTEVTEEGFVGGPVMPGNFDGSPETIEQLRLNIARAGVVGS
LISTDYHSSMIEIPLLATVDGQPLSYQDLSEALERIRVKYEGADLGIYITGFAKISGDMI
DGIYKVMLFFIVAALVAALIIYFHTRCVRSTALVLLCSVIAVLWQQGLVIAFGGVLDAFT
ILIPFLIFAIGVSHGLQKMNGIAQDIARGTHPWVAARYTFRRLFLPGLIALIADGVGFAV
LVLVDIPIIRELALSASLGFAMLVVTNLILLPVLLSFTGISQEAARRHIIEHDTTIHKLG
IDRVWNSLDRFTERRWAVLAIAVALGLTVLALVERSKLQVGDLHAGSPELRPDSRYNRDN
AFITSRFGVSSDVFAVMIKTPADQCGSYEALIEADRLARQLSQVPGVQATASLADTVRAY
TSGGFEGSPKWFTISDNKGVLWPQVNNALVWNSQFLNSECSLMPVLAYLSDHKAATLDAV
LKVASEFAEQHSVKDRQFLLAAGSAGIEAATNIVVKSVQLEMLLAVYFAVALLCLMTFRS
WRAVVVALLPLVLTSLLAEALMVQLNIGLKVATLPVVALGVGVGVDYALYLLSVQLEGQR
MGLSLQQAYRRAIQFTGKMVALVGVTLAVGVVTWVGSPIKFQADMGILLAFMFLWNMLAA
LVLIPALSHFLLNGRHFHVFQAKAFAEQGNSMGRLQATGHSTRAESVRASV