Protein Info for Pf6N2E2_1843 in Pseudomonas fluorescens FW300-N2E2

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00106: adh_short" amino acids 5 to 190 (186 residues), 143.6 bits, see alignment E=8.5e-46 PF13561: adh_short_C2" amino acids 10 to 189 (180 residues), 99.8 bits, see alignment E=2.9e-32 PF08659: KR" amino acids 51 to 159 (109 residues), 35.5 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 55% identity to sch:Sphch_0165)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUJ4 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Pf6N2E2_1843 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Pseudomonas fluorescens FW300-N2E2)
MNQNVLFITGAGSGLGQLSAKRALSDGWAVAAMDINEAGLNQLGSSPRLLKLVVDITDPT
AVEAAVERCETELGPITRLTNAAAIMPLGLLMEQPREVIQNIMAINFGGMVNLSKAALPK
MIARGRGEFVSYASMAGHWPIIYMGAYNAAKHAVTAYTEVLFHETRNSGVRIVCVCPPIV
ATPLLDQAKSTVWPKIFDVFPPITAEVVLNKIERVLKGNKLWVFPGPMTAMSWRLRRWIP
NILWWTVHQVEKI