Protein Info for Pf6N2E2_1839 in Pseudomonas fluorescens FW300-N2E2

Annotation: 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (EC 1.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF00106: adh_short" amino acids 10 to 189 (180 residues), 172.6 bits, see alignment E=1.4e-54 PF08659: KR" amino acids 12 to 180 (169 residues), 32.9 bits, see alignment E=1.2e-11 PF01370: Epimerase" amino acids 12 to 136 (125 residues), 23.9 bits, see alignment E=5.1e-09 PF13561: adh_short_C2" amino acids 18 to 242 (225 residues), 193.8 bits, see alignment E=7.2e-61

Best Hits

Swiss-Prot: 45% identical to FABG_ECOLI: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 57% identity to bpe:BP2094)

MetaCyc: 48% identical to BadH (Rhodopseudomonas palustris)
R267-RXN

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z491 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Pf6N2E2_1839 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (EC 1.1.1.-) (Pseudomonas fluorescens FW300-N2E2)
MTMRALTGQRAFVTGGSKGIGEAIVRRLAAEGAKVVIAAQDMISAERLADEVGGLAVRLD
VTDLLEVERVVTMLGPFEILVNNAGYDQHDFFTKTTVEQWRYLLAVNLEGVFASTHAALP
AMQAAGYGRIINVGSEAGRQGSKGGAVYAAAKGGVIAFSKSIARENARYGITVNVVAPGP
VDTPLLRKALDRGGEKLLAAMEASTLVGRLGEPNEVAAAVVFLASRDASFITGETLGVSG
GMGC