Protein Info for Pf6N2E2_1835 in Pseudomonas fluorescens FW300-N2E2

Annotation: Enoyl-CoA hydratase (EC 4.2.1.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 41 to 63 (23 residues), see Phobius details PF00378: ECH_1" amino acids 1 to 197 (197 residues), 127.5 bits, see alignment E=5.8e-41 PF16113: ECH_2" amino acids 2 to 152 (151 residues), 67.5 bits, see alignment E=1.5e-22

Best Hits

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>Pf6N2E2_1835 Enoyl-CoA hydratase (EC 4.2.1.17) (Pseudomonas fluorescens FW300-N2E2)
MFSAGGDIATMADLDESGARERMQHIHQLCRLLGQFPMPVISAVEGICAGAGVGLALLGD
VVLSGTKTRFLFPFLKLGLSPDWGLLRTLPARVGVAEAKRMLTHGQYISAEEAVVAGLAD
ECVGLNVMDSAVSLASRMSRLPRDAFSRMKNRLDHPSASLAEELQREEDDQAVLLLGADF
REGFAAFAEKREPQFTSTVDYLV