Protein Info for Pf6N2E2_1815 in Pseudomonas fluorescens FW300-N2E2

Annotation: Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF01546: Peptidase_M20" amino acids 82 to 378 (297 residues), 94 bits, see alignment E=1.2e-30 PF07687: M20_dimer" amino acids 184 to 282 (99 residues), 69.3 bits, see alignment E=2.6e-23

Best Hits

KEGG orthology group: K01295, glutamate carboxypeptidase [EC: 3.4.17.11] (inferred from 94% identity to pba:PSEBR_a2190)

Predicted SEED Role

"Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases"

Isozymes

Compare fitness of predicted isozymes for: 3.4.17.11

Use Curated BLAST to search for 3.4.17.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVZ6 at UniProt or InterPro

Protein Sequence (384 amino acids)

>Pf6N2E2_1815 Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases (Pseudomonas fluorescens FW300-N2E2)
MSATAQQALDWLADQRPAMEALLQRIVDTDSNSYDKAGVDAVGALLAAELEADGILLKRM
PVESFGDVMLAEVPGEPGKPVLLLGHRDTVFPKGTTTTRGYSRDGNLAFGPGVADMKGGL
VLNCFALKALKRAGALPYPVQVLYTGDEEIGSGSARTHIEHAARAARAVLNTEPGRASGN
VVSARKGGATLIIEVSGRAAHAGVNHADGASAIEALARKIVKLHALTDYSAGITTNVGLI
SGGTSSNTVAPSACARLDVRFIELKHWDQILSAILAIVAEEELIGTHAILKEATTFLPME
ARHSERLLQIYQQKALALGFSVEGEFTGGCADSGFTASLGIPTLCGLGPVGGKVHTNREY
LELDTLVPRAQALVATILAVGESG