Protein Info for Pf6N2E2_1813 in Pseudomonas fluorescens FW300-N2E2

Annotation: ABC-type oligopeptide transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF00005: ABC_tran" amino acids 33 to 181 (149 residues), 134.8 bits, see alignment E=5.1e-43 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 230 to 316 (87 residues), 62.8 bits, see alignment E=1.3e-21 PF08352: oligo_HPY" amino acids 232 to 297 (66 residues), 56.4 bits, see alignment E=4.6e-19

Best Hits

Swiss-Prot: 50% identical to Y4TS_SINFN: Probable peptide ABC transporter ATP-binding protein y4tS (NGR_a01400) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 96% identity to pba:PSEBR_a2192)

Predicted SEED Role

"ABC-type oligopeptide transport system, ATPase component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZY58 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Pf6N2E2_1813 ABC-type oligopeptide transport system, ATPase component (Pseudomonas fluorescens FW300-N2E2)
MKKDIALELCDIRREFRINKGFFKPTATLKAVDGVSLRLMRGETLGLVGESGCGKSTLAK
LLLGLLAPTSGDVLINGKHLAATDRKAMARHIQPIFQDPYSSLNPRKTLREIITLPLIVH
DIGSPAERRKKTEAMLDVVGLPKRVIDSYPSQLSGGQRQRVAIARALIMRPDVLICDEPT
SALDVSVQAQILNLLQDLKREFGLTYLLISHNLAVIEHLADRVAVMYLGRIVEERTRESL
FAKPGHPYTRALLDSVLTPDPRLGIPEIGLHGTFPNPMSPPSGCAFHPRCPSCFAPCKTA
YPANDPIIGGNVRCHLHDSPAQTLELVHS