Protein Info for Pf6N2E2_1812 in Pseudomonas fluorescens FW300-N2E2

Annotation: peptide ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF00005: ABC_tran" amino acids 29 to 187 (159 residues), 101.3 bits, see alignment E=1.1e-32 PF13304: AAA_21" amino acids 155 to 223 (69 residues), 28.2 bits, see alignment E=2.8e-10 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 236 to 321 (86 residues), 78.6 bits, see alignment E=1.5e-26 PF08352: oligo_HPY" amino acids 238 to 304 (67 residues), 64.3 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 95% identity to pba:PSEBR_a2193)

Predicted SEED Role

"peptide ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWZ9 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Pf6N2E2_1812 peptide ABC transporter, ATP-binding protein (Pseudomonas fluorescens FW300-N2E2)
MALLHVENLRVDIPMGNSPTPDDMLHAVRGLDFEVERGEMLCIVGESGCGKSLTSLALMD
LLPRKARRTASRLTLDGIDMLGQSERRMCDLRGNRLAMIFQEPMTSLNPAYSIGDQLSEV
LTQHRKVSRKDALARAAQMLEKVGISNAAERLRQYPHQLSGGLRQRVIIAMALMCEPDLI
IADEPTTALDVTIQAQILRLIRDIQKELGLAVIFITHDLGLVARIADRVAVMYAGEIVET
APARQLFENPQHPYTRGLLASIPIPGRTKPGEALGSIPGLVPSLVGEQQGCAFRNRCAQA
ITACAQDIPEIEQDGHMARCLFAAPAPAPIRLQERARS