Protein Info for Pf6N2E2_1805 in Pseudomonas fluorescens FW300-N2E2

Annotation: Multidrug resistance protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 287 to 311 (25 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details PF07690: MFS_1" amino acids 2 to 339 (338 residues), 143.3 bits, see alignment E=9.2e-46 PF12832: MFS_1_like" amino acids 14 to 356 (343 residues), 51.1 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2200)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUG3 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Pf6N2E2_1805 Multidrug resistance protein B (Pseudomonas fluorescens FW300-N2E2)
MIVSLTIVVSRAITSPLLTLFLSNKLGLNQQDVGLLLGIAVFIATLLALYGGYVIDRLEK
RRLLILAMLSSAIGFILLTFAENLYLTTMTVVITETASALFLIGSKAILSENLPMGQRAK
AFSLRYTLTNIGYATGPMLGVVIAGVYPIAPFLIAGGIAFFSIFLMTGIPRDAALTPVIG
QPPSFLKTLKTLKNDRTLIMFTCGCLLSTVVHGRFTLYLSQYLLVTHDSKRALDIMAALL
ACNAVTVILLQYQIGRFLDREKLRYWIAAGTSLFILGLIGFSLADDMVSWCVAMFIFTLG
EMIIYPAEFLFVDTLAPEELRGSYYGAQNLAALGGALSPVICGYLLMHTPAPTMFYALSA
LTAMGGLLCFMSGRRMAIVKK