Protein Info for Pf6N2E2_1799 in Pseudomonas fluorescens FW300-N2E2

Annotation: ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details amino acids 74 to 100 (27 residues), see Phobius details amino acids 111 to 142 (32 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 70 to 179 (110 residues), 67.3 bits, see alignment E=7e-23 PF00528: BPD_transp_1" amino acids 90 to 285 (196 residues), 80.9 bits, see alignment E=5.2e-27

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 97% identity to pfo:Pfl01_2853)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWD7 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Pf6N2E2_1799 ABC transporter permease protein (Pseudomonas fluorescens FW300-N2E2)
MSQTQAERLQAERKLAENQFDITQYDHVPRRYYGRIFFATVIVIALIGLVRAFAEGKIEW
SYIGQFLTSQAIMWGLLNTVVMAVLAMALGIVFGVITAIMRMSANPILRYVALIYTWLFR
GTPLILQLLLWFNLALIFPTIGIPGLFEMDTVSLMTPFVAALLGLSINQGAYTAEVVRAG
LLSVDTGQYEAAKSIGMPRLQALRRIILPQAMRIIIPPVGNEFIGMVKMTSLASVIQYSE
LLYNAQNIYYANARVMELLIVAGIWYLATVTVLSFGQSRLERRFARGAGKRS